Echistatin α1 isoform

231 € – 704 €

Currency

Echistatin was originally purified from the venom of the viper Echis carinatus. Echistatin is a cyclic RGD peptide that inhibits platelet aggregation by inhibiting the glycoprotein IIb/IIIa complex receptor. Echistatin is a potent disintegrin that antagonize αVβ3 integrin and has been described to inhibit cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.

 

SKU: ECH001 Category: Tags: ,

Description

AA sequence H-ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT-OH
Disulfide bond 2-11, 7-32, 8-37, 20-39
Formula C217H341N71O74S9
MW 5417,05 g/mol
Purity >95%

 

Echistatin. A potent platelet aggregation inhibitor from the venom of the viper, Echis carinatus.

Imaging tumor angiogenesis with contrast ultrasound and microbubbles targeted to alpha(v)beta3
Disintegrin targeting of an αvβ3 integrin-over-expressing high-metastatic human osteosarcoma with echistatin inhibits cell proliferation, migration, invasion and adhesion in vitro.

Sign Up to our Newsletter

    Placeholder

    Echistatin α1 isoform

    231 € – 704 €Quote request